PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26125
Common NameKK1_027112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 567aa    MW: 63964.2 Da    PI: 4.4649
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26125genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52201462128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    +pGfrFhPtdeelv++yLk+k+ gk+l+l +vi+ +d+yk++P dLp +  +k+++++w+fF++rd+ky++g r+nrat++gyWkatgkd++v++ 
  C.cajan_26125  20 MPGFRFHPTDEELVMYYLKRKICGKRLKL-DVIRVTDVYKWDPDDLPgQsILKTGDRQWFFFCHRDRKYPNGGRSNRATRHGYWKATGKDRNVVC- 113
                    69***************************.99**************96446788999**************************************. PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kktLvfy grap+ge+tdWvmhey++
  C.cajan_26125 114 NSRTVGVKKTLVFYVGRAPSGERTDWVMHEYTM 146
                    999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5914169IPR003441NAC domain
PROSITE profilePS5100553.22919169IPR003441NAC domain
PfamPF023656.1E-2821145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MGEASEAGST DCFSQMMSSM PGFRFHPTDE ELVMYYLKRK ICGKRLKLDV IRVTDVYKWD  60
PDDLPGQSIL KTGDRQWFFF CHRDRKYPNG GRSNRATRHG YWKATGKDRN VVCNSRTVGV  120
KKTLVFYVGR APSGERTDWV MHEYTMDEGE LKRCQGVKDY YALYKVYKKS GPGPKNGEQY  180
GAPFNEEEWA DDDIVDFNDN KSDQVAPNDV PGDYSALQPL LDDEIGDIIR EILDDELVLE  240
PQHLNGYPDF PQVVTEETQS TIADQFSEDV VFPEQISIFH PNSQFFDAQP SFDFNQAVTS  300
QLHVSEASEV SSVSNIKTKG LDFHEDGFLE IDDLNDTEPT LSNLEKPMEY QQFEDGLSEL  360
DLYQDAEMFL RDLGPIIHET DSHAYSNALV SSNFESQNCQ LLPNLEDANQ TVSEFWMHGE  420
RNTQSQSEGF VDSFSLSSPV FFGRVLGVVY ESVSFPTEGN NNQSSTLEDV ATSSFSSALW  480
AFVESIPTTP ASAAESALVN RALNRMSSFS RLKIKHTNIA AGKDTATMKR AGRKGLQFLF  540
FPILIALCAF LWIFIGNLRL LGRCISP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-482114617140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13746KRKICGKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6573050.0KF657305.1 Glycine max NAC transcription factor (SNAC38) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274375.10.0uncharacterized protein LOC100794925
TrEMBLA0A151S8K10.0A0A151S8K1_CAJCA; NAC domain-containing protein 78
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-132NAC domain containing protein 17